Review



biotinylated antigen specific peptide  (Synpeptide Co Ltd)

 
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 86
      Buy from Supplier

    Structured Review

    Synpeptide Co Ltd biotinylated antigen specific peptide
    Biotinylated Antigen Specific Peptide, supplied by Synpeptide Co Ltd, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/biotinylated+antigen+specific+peptide/antigen+biotinylated+peptide+specific/us12534533-649-4-14
    Average 86 stars, based on 1 article reviews
    biotinylated antigen specific peptide - by Bioz Stars, 2026-11
    86/100 stars

    Images

    Related Articles

    Incubation:

    Article Title: Anti-chemokine like receptor 1 humanized antibodies and their therapeutic applications
    Article Snippet: After incubation and washing, mouse anti-human kappa antibody (Ose Immunotherapeutics, reference NaM76-5F3) was added and detected by peroxidase-labeled donkey anti-mouse IgG antibody (Jackson Immunoresearch; USA; reference 715-036-151). .. After incubation and washing, biotinylated antigen-specific peptide (Biot-C7 peptide: biotinylated NH2-PYHTLNLLELHHTAMPGSVFSLGLPLATALAIA-OOOH, synthetized by synpeptide, SEQ ID No. 60) then, peroxidase-streptavidin (Jackson Immunoresearch; USA; reference 016-030-084) was added and revealed by conventional methods. .. For activity ELISA assay, donkey anti-human IgG, Fc specific (Jackson Immunoresearch; USA; reference 709-005-098) was immobilized on plastic at 1.3 μg/ml in borate buffer (pH9) and purified antibody were added to measure binding in BSA1% buffer, compared to wild-type 2G1.

    Article Title: Anti-chemokine like receptor 1 humanized antibodies and their therapeutic applications
    Article Snippet: For activity ELISA assay, donkey anti-human IgG, Fc specific (Jackson Immunoresearch; USA; reference 709-005-098) was immobilized on plastic at 1.3 μg/ml in borate buffer (pH9) and purified antibody was added to measure binding in BSA1% buffer, compared to wild-type 2G1. .. After incubation and washing, biotinylated antigen-specific peptide (Biot-C7 peptide: biotinylated NH2-PYHTLNLLELHHTAMPGSVFSLGLPLATALAIA —COOH, synthetized by synpeptide, SEQ ID No. 60) then, peroxidase-streptavidin (Jackson Immunoresearch; USA; reference 016-030-084) was added and revealed by conventional methods. .. For activity ELISA assay, donkey anti-human IgG, Fc specific (Jackson Immunoresearch; USA; reference 709-005-098) was immobilized on plastic at 1.3 μg/ml in borate buffer (pH9) and purified antibody was added to measure binding in BSA1% buffer, compared to wild-type 2G1.



    Similar Products

    biotinylated antigen specific peptide  (Synpeptide Co Ltd)
    86
    Synpeptide Co Ltd biotinylated antigen specific peptide
    Biotinylated Antigen Specific Peptide, supplied by Synpeptide Co Ltd, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/biotinylated+antigen+specific+peptide/antigen+biotinylated+peptide+specific/us12534533-649-4-14
    Average 86 stars, based on 1 article reviews
    biotinylated antigen specific peptide - by Bioz Stars, 2026-11
    86/100 stars
    		  Buy from Supplier

    Image Search Results